A0A1B0GV53 identified as C-type lectin in LectomeXplore
A0A1B0GV53
Redundant proteins identified: KAI2577417.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: S-CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERG-----AHLVVIKSAEEQEFLQ-----QLSKSNSY-WIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNN----AGN-EDCV----EIKANG--WNDVKCEKKKLAICEKEAA
PREDICTED: SLCPLFWMEFKGHCYRFFPLNKTWAEADLYCSEFSVGRKSAKLASIHSWEENVFVYDLVNSCVPGIPADVWTGLHDHRQEGQFEWTDGSSYDYSYWDGSQPDDGVHADPEEEDCVQIWYRPTSALRSWNDNTCSRKFPFVCKIPSL
View sequence for C-type lectin 38 : 183View gene sequenceView neighboring sequences
Cite How to cite