Q96DA0 identified as Jacalin-like in LectomeXplore
Q96DA0
Redundant proteins identified: G8H6I3 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: SGPWGGNG-GSAFDDSAV--TGITSIEISSGD---GSISVTYDSVGSD-YGGSGGKSEEIELGPGEYITSISGTYGNYVRSLTFKTNK-RTYPYGTEAGTPF-SLPIE-NGKIVGFKGRSGDY-LDAIGIYLEQRDVE
PREDICTED: AGKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEE
View sequence for Jacalin-like 52 : 189View gene sequenceView neighboring sequences
Cite How to cite