Q07654 identified as Trefoil Factor in LectomeXplore
Q07654
Redundant proteins identified: 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: SAETCAVAAKERVDCGYPGVTPKECANKGCCFDDRVRGVPWCFKP--E
PREDICTED: SANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQE
View sequence for Trefoil Factor 28 : 75View gene sequenceView neighboring sequences
Cite How to cite