O43699 identified as I-type lectin in LectomeXplore
O43699
Redundant proteins identified: A0A024R4K4 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: LYGLQVPKSVSAQEGLCVSIPCSFSYPDE-LRSAVVHGVWYRDYPKNKEPVVTKSRDQVVHEEFQGRFRLLGDLGKKNCTLLLSDLRKEDKGKYFFRVERG----SYKQTKLSVEVLDLVNKPNIVVPEEVVAGTEVEVSCSVPDNCEE-LRPELSWLGGRLREDEGTTVQVSLLHLVPTREANGTRLGCQAAFPNATLQFEGYVSLDVKYPPV---------------IVEMNSSVEAIEGSHVSLLCGADSNPPPLLTWMRDGMVLREA-VAKSLYLDLEEVTPGEDGVYACLAENAYGQD
PREDICTED: RFQLEGPESLTVQEGLCVLVPCRL--PTTLPASYYGYGYWFLE--GADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSL
View sequence for I-type lectin 30 : 328View gene sequenceView neighboring sequences
Cite How to cite