P35247 identified as C-type lectin in LectomeXplore
P35247
Redundant proteins identified: AAB59450.1 AAH22318.1 KAI4076611.1 CAG46746.1 AAO22991.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: KKEKSELKKVAALEKKLEELKKEVEKLKS---CPKKWKAFQ-----GKCYFFSN-EKKTWEEAEKACSERGAHLVVIKSAEEQEFLQ-QLSKSNSY-WIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNNAGN-EDCVEIKANG-WNDVKCEKKKLAICEK
PREDICTED: AKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
View sequence for C-type lectin 215 : 375View gene sequenceView neighboring sequences
How to cite: François Bonnardel, Julien Mariethoz, Serge Pérez, Anne Imberty, Frédérique Lisacek, LectomeXplore, an update of UniLectin for the discovery of carbohydrate-binding proteins based on a new lectin classification, Nucleic Acids Research doi.org/10.1093/nar/gkaa1019