Q8IWL1 identified as C-type lectin in LectomeXplore
Q8IWL1
Redundant proteins identified: E3VLD0 B2R7Z9 ADO27667.1 AAI57867.1 AAI57891.1 BAG35996.1 AAA36520.1 AAA60319.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: KKEVEKLKS--CPKKWKAFQGKCYFFSN-EKKTWEEAEKACSERGAHLVVIKSAEEQEFLQ-QLSKSNSY-WIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNNAGNEDCVEIKANG-WNDVKCEKKKLAICEK
PREDICTED: RHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
View sequence for C-type lectin 115 : 248View gene sequenceView neighboring sequences
Cite How to cite