Q06141 identified as C-type lectin in LectomeXplore
Q06141
Redundant proteins identified: Q53S56 AAA36415.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: EELKKEVEKLKS-CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERG-AHLVVIKSAEEQEFLQ----QLSKSNSY-WIGLTDEKT----EGT-WQWVDGSPLNYKNWAPGEPNNAGN-EDCVEIKANG----WNDVKCEKKKLAICEKE
PREDICTED: EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERN-PSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFT
View sequence for C-type lectin 27 : 174View gene sequenceView neighboring sequences
Cite How to cite