P48304 identified as C-type lectin in LectomeXplore
P48304
Redundant proteins identified: Q6ICS1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: ELKKEVEKLKS----CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERG-AHLVVIKSAEEQEFLQ----QLSKSNSY-WIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNNAGNEDCV---EIKANG---WNDVKCEKKKLAICEKE
PREDICTED: QGQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASLTSCS--GFKKWKDESCEKKFSFVCKFK
View sequence for C-type lectin 21 : 165View gene sequenceView neighboring sequences
Cite How to cite