Q96A99 identified as Pentraxin in LectomeXplore
Q96A99
Redundant proteins identified: KAI2576353.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: VFVFPKESVTDYVSLKAPLEKPLKAFTLCLRAYSELSRAYSLFSYATKRRDNELLVYKEKV---IEYSLTVGRSKVLSKVIEKTV---APVHICVSWESASGIVEFWVDGKPLVKKS-LKKGYTVEAEAKIVLGQEQDSYGGKFERSQSLVGEIGDLYMWDSVLSPEEILSIYLGTPLSA
PREDICTED: TLVFPNASTRNVVFLSPGFVTALRALSFCSWVRTASGRLGTLLSYATEDNDNKLVLHGRDSLLPGSIHFVIGDPAFR-ELPLQLLLDGQWHHICVIWTSTQGRYWLHVDRRLVATGSRFREGYEIPPGGSLVLGQEQDSVGGGFDSSEAFVGSMSGLAIWDRALVPGEVANLAIGKEFPT
View sequence for Pentraxin 272 : 450View gene sequenceView neighboring sequences
Cite How to cite