P26022 identified as Pentraxin in LectomeXplore
P26022
Redundant proteins identified: AAA61234.1 KAI2532138.1 AAH39733.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: VFVFPKESVTDYVSLKAPLEKPLKAFTLCLRAY-SELSRAYSLFSYATKRRDNELLVYKEKVIEYSLTVGRS--KVLSKVIEKTVAPVHICVSWESASGIVEFWVDGKPLV-KKSLKKGYTVEAEAKIVLGQEQD--SYGGKFERSQSLVGEIGDLYMWDSVLSPEEILSI--YLGTPLSANVLDW
PREDICTED: AILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYLSYQ-SIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGW
View sequence for Pentraxin 182 : 366View gene sequenceView neighboring sequences
Cite How to cite