P13727 identified as C-type lectin in LectomeXplore
P13727
Redundant proteins identified: CAA81207.1 BAG35128.1 AAA35796.1 KAI2559936.1 AAA36203.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: Q--------GKCYFFSNEKKTWEEAEKACSERG-AHLVVIKSAEEQEFLQ--QLSKSNSY-WIG--LTDEKTEGTWQWVDGSPLNYKNWAPGEPNNAGNEDCVEIKANG--WNDVKCEKKKLAICE
PREDICTED: KVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRG-GHCVALCTRGGHWRRAHCLRRLPFICS
View sequence for C-type lectin 97 : 221View gene sequenceView neighboring sequences
Cite How to cite