O95502 identified as Pentraxin in LectomeXplore
O95502
Redundant proteins identified: A0A1X7SBT7 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: LKAFTLCLRAYSELS--RAYSLFSYATKRRDNELLVYKEKVIEYSLTVGRSKVLSKVIEKTVAPVHICVSWESASGIVEFWVDGKPLVK-KSLKKGYTVEAEAKIVLGQEQDSYGGKFERSQSLVGEIGDLYMWDSVLSPEEILSIYL-GTPLSANVLDWRA
PREDICTED: LYAFTACMWLRSRSSGTGQGTPFSYSVPGQANEIVLLEAGHEPMELLINDKVAQLPLSLKDNGWHHICIAWTTRDGLWSAYQDGELQGSGENLAAWHPIKPHGILILGQEQDTLGGRFDATQAFVGDIAQFNLWDHALTPAQVLGIANCTAPLLGNVLPWED
View sequence for Pentraxin 316 : 477View gene sequenceView neighboring sequences
Cite How to cite