Q15818 identified as Pentraxin in LectomeXplore
Q15818
Redundant proteins identified: KAI4052058.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: FPKESVTDYVSLKAPLEKPLKAFTLCLRAYSELSRAY-SLFSYATKRRDNELLVYKEKVIEYSLTVGRSKVLSKVIEKTVAPVHICVSWESASGIVEFWVDGKPLVK-KSLKKGYTVEAEAKIVLGQEQDSYGGKFERSQSLVGEIGDLYMWDSVLSPEEILSIY--LGTPLSANVLDWRALKYEVRG
PREDICTED: FPLRTNYMYAKVKKSLPE-MYAFTVCMWLKSSATPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGSGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIAWAESHIEIYG
View sequence for Pentraxin 232 : 418View gene sequenceView neighboring sequences
How to cite: François Bonnardel, Julien Mariethoz, Serge Pérez, Anne Imberty, Frédérique Lisacek, LectomeXplore, an update of UniLectin for the discovery of carbohydrate-binding proteins based on a new lectin classification, Nucleic Acids Research doi.org/10.1093/nar/gkaa1019