P26717 identified as C-type lectin in LectomeXplore
P26717
Redundant proteins identified: J3KPJ4 A0A897PVC2 CAA38651.1 QSG30230.1 AAH93644.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: KKEVEKLKS-CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQQLSKSNSYWIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNNAGNEDCVEIKANGWNDVKCEKKKLAICEK
PREDICTED: RTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPS--SWIGVFRNSSHHPWVTINGLAFKHK--IK-DSDNAE-LNCAVLQVNRLKSAQCGSSMIYHCKH
View sequence for C-type lectin 107 : 229View gene sequenceView neighboring sequences
Cite How to cite