O14594 identified as C-type lectin in LectomeXplore
O14594
Redundant proteins identified: A0A024R7M3 AAC80576.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: S-CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQQLSKSNSYWIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNN--AGNEDCV--EIKANG-WNDVKCEKKKLAICEKEAASC
PREDICTED: EGCDRGWHKFQGHCYRYFAHRRAWEDAEKDCRRRSGHLTSVHSPEEHSFINSFGHENT-WIGLNDRIVERDFQWTDNTGLQFENWRENQPDNFFAGGEDCVVMVAHESGRWNDVPCNYNLPYVCKKGTVLC
View sequence for C-type lectin 1086 : 1215View gene sequenceView neighboring sequences
Cite How to cite