Q9UBG0 identified as C-type lectin in LectomeXplore
Q9UBG0
Redundant proteins identified: AAD30280.1 AAF14192.1 
Structural models
AlphaFold v2: AF-Q9UBG0-F1Download
  Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
View sequence for C-type lectin 235 : 367View sequence for C-type lectin 379 : 509View sequence for C-type lectin 512 : 647View sequence for C-type lectin 666 : 814View sequence for C-type lectin 827 : 961View sequence for C-type lectin 972 : 1114View sequence for C-type lectin 1137 : 1245View sequence for C-type lectin 1268 : 1402View sequence for Cys-rich man-receptor 43 : 172View gene sequenceView neighboring sequences
REFERENCE: KS-CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQ-QLSKSNSY-WIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNN-AGN-EDCVEIKANG--WNDVKCEKKKLAICEKEAA
PREDICTED: KVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQ
Cite How to cite