Q9UBG0 identified as C-type lectin in LectomeXplore
Q9UBG0
Redundant proteins identified: AAD30280.1 AAF14192.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: KS-CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQ-QLSKSNSY-WIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNN-AGN-EDCVEIKANG--WNDVKCEKKKLAICEKEAA
PREDICTED: KVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQ
View sequence for C-type lectin 235 : 367View sequence for C-type lectin 379 : 509View sequence for C-type lectin 512 : 647View sequence for C-type lectin 666 : 814View sequence for C-type lectin 827 : 961View sequence for C-type lectin 972 : 1114View sequence for C-type lectin 1137 : 1245View sequence for C-type lectin 1268 : 1402View sequence for Cys-rich man-receptor 43 : 172View gene sequenceView neighboring sequences
How to cite: François Bonnardel, Julien Mariethoz, Serge Pérez, Anne Imberty, Frédérique Lisacek, LectomeXplore, an update of UniLectin for the discovery of carbohydrate-binding proteins based on a new lectin classification, Nucleic Acids Research doi.org/10.1093/nar/gkaa1019