P22897
Redundant proteins identified: Q0Z8D6 B9EJA8 ABG47462.1 EAW86205.1 CAH71176.1 AAI46839.1
Amino acid conservation
Reference conserved motif. Graphics generated by Skylign
Gene viewer
View sequence for C-type lectin 233 : 347View sequence for C-type lectin 360 : 493View sequence for C-type lectin 499 : 635View sequence for C-type lectin 646 : 787View sequence for C-type lectin 802 : 932View sequence for C-type lectin 940 : 1086View sequence for C-type lectin 1102 : 1217View sequence for C-type lectin 1236 : 1382View sequence for Cys-rich man-receptor 21 : 154View gene sequenceView neighboring sequences
REFERENCE: KKWKAFQGKCYFFSN-EKKTWEEAEKACSERGAHLVVIKSAEEQEFLQ----QLSKSNSYWIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNNAGNEDCVEIKANG--WNDVKCEKKKLAICEKEAASCSKEEESVESIENYTCKCDPG
PREDICTED: TAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIGLFRN-VEGTWLWINNSPVSFVNWNTGDPSGER-NDCVALHASSGFWSNIHCSSYKGYICKRPKIIDAKPTHELLTTKADTRKMDPS
By using this site you agree to our privacy policy.
Please confirm you agree with the privacy policy before using the site.