P11226 identified as C-type lectin in LectomeXplore
P11226
Redundant proteins identified: AAH96182.3 AAK52907.1 AAH96181.3 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: EKKLEELKKEVEKLKSCPKKWKAFQ-----GKCYFFSN-EKKTWEEAEKACSERGAHLVVIKSAEEQEFLQQLSKSNSYWIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNNAGN-EDCVEIKANG-WNDVKCEKKKLAICEKE
PREDICTED: ASERKALQTEMARIK----KWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEA-FLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFP
View sequence for C-type lectin 109 : 247View gene sequenceView neighboring sequences
Cite How to cite