P16581 identified as C-type lectin in LectomeXplore
P16581
Redundant proteins identified: B2RAJ1 AAA52376.1 BAG36888.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: CYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQ-QLSKSNSY-WIGLTDEKTEGTWQWVDGSPLNY---KNWAPGEPNNAGN-EDCV-----EIKANG-WNDVKCEKKKLAICEK---EAASCSKEEESVESIENYTCKCDPGFSGLKCEQVKDDDALI
PREDICTED: SYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKV--NNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALE
View sequence for C-type lectin 23 : 184View gene sequenceView neighboring sequences
Cite How to cite