Q12907 identified as ERGIC-VIP L-type in LectomeXplore
Q12907
Redundant proteins identified: A0A384NPY7 A8K7T4 BAF84788.1 BAD96329.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: SSRRLEYKYSLKGPYLVQSDGTVPLWAFAGNAILSSDQIRLAPSLKSKRGSVWTKTKAALENWEVEVTFRVTGRGR--IGADGLAIWYTENQGLEGPVFGSADLFNGVGIFLDSFDNDEKKEN--PAIVVVGNNGQISYDHQKDGASQALASCQRDFRNKDYDVRAKITYYQKTLTVMINLEDKNDYEFCAKVENVVIPTQGYFGISAATGGLADDHDVLSLLLFQLI
PREDICTED: NSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLM
View sequence for ERGIC-VIP L-type 50 : 277View sequence for Yeast Emp L-type 75 : 275View gene sequenceView neighboring sequences
Cite How to cite