P49257 identified as ERGIC-VIP L-type in LectomeXplore
P49257
Redundant proteins identified: A0A024R2A7 B2R774 Q53FS4 BAG35721.1 BAD96928.1 AAH32330.1 CAA50653.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: LSSRRLEYKYSLKGPYLVQSDGTVPLWAFAGNAILSSDQIRLAPSLKSKRGSVWTKTKAALENWEVEVTFRVTGRGRIGADGLAIWYTENQGLEGPVFGSADLFNGVGIFLDSFDNDEKKENPAIVVVGNNGQISYDHQKDGASQALASCQRDFRNKDYDVRAKITYYQKTLTVMIN---LEDKNDYEFCAKVENVVIPTQGYFGISAATGGLADDHDVLSLLLFQLIEP
PREDICTED: LPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEP
View sequence for ERGIC-VIP L-type 41 : 270View gene sequenceView neighboring sequences
Cite How to cite