Q9HAT1 identified as ERGIC-VIP L-type in LectomeXplore
Q9HAT1
Redundant proteins identified: A8K704 AAG30902.1 BAF84508.1 KAI2575176.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: SSRRLEYKYSLKGPYLVQSDGTVPLWAFAGNAILSSDQIRLAPSLKSKRGSVWTKTKAALENWEVEVTFRVTGRGRIGADGLAIWYTENQGLEGPVFGSADLFNGVGIFLDSFDNDEKKENPAIVVVGNNGQISYDHQKDGASQALASCQRDFRNKDYDVRAKITYYQKTLTVMIN--LEDKNDYEFCAKVENVVIPTQGYFGISAATGGLADDHDVLSLLLFQLIEP
PREDICTED: PLRRFEYKLSFKGPRLALPGAGIPFWSHHGDAILGLEEVRLTPSMRNRSGAVWSRASVPFSAWEVEVQMRVTGLGRRGAQGMAVWYTRGRGHVGSVLGGLASWDGIGIFFDSP-AEDTQDSPAIRVLASDGHIPSEQPGDGASQGLGSCHWDFRNRPHPFRARITYWGQRLRMSLNSGLTPSDPGEFCVDVGPLLLVPGGFFGVSAATGTLADDHDVLSFLTFSLSEP
View sequence for ERGIC-VIP L-type 29 : 255View gene sequenceView neighboring sequences
Cite How to cite