P56470 identified as galectin-like in LectomeXplore
P56470
Redundant proteins identified: Q6FHZ4 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: ALSLSSSGSPIYNLPVPYLVTLNAGLKPGSLVTIKGSVASNAKRFAVNLGTGSS---DIALHFNPRFDENG-IVCNSKENGSWGQEEREKAFPFQKGKEFEITILVDPDKFKVKVNGKHVLEYPHRLKLEAVSYLQVEGDIQLTSVSVSGLKLLAAAE
PREDICTED: AYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQG
View sequence for galectin-like 2 : 159View sequence for galectin-like 176 : 322View gene sequenceView neighboring sequences
Cite How to cite