P17931 identified as galectin-like in LectomeXplore
P17931
Redundant proteins identified: A0A024R693 Q6FGL0 Q6NVH9 CAG46894.1 AAA88086.1 AAH68068.1 AAA35607.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: SSSGSPIYNLPVPYLVTLNAGLKPGSLVTIKGSVASNAKRFAVNLGTGSSDIALHFNPRFDENG---IVCNSKENGSWGQEEREKAFPFQKGKEFEITILVDPDKFKVKVNGKHVLEYPHRLK-LEAVSYLQVEGDIQLTSVSVSG
PREDICTED: GPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGN-DVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTM
View sequence for galectin-like 105 : 249View gene sequenceView neighboring sequences
Cite How to cite