P09382 identified as galectin-like in LectomeXplore
P09382
Redundant proteins identified: A0A384MR27 1W6Q_A 1W6M_B 1GZW_B 1W6Q_B 1GZW_A 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: PVPYLVTLNAGLKPGSLVTIKGSVASNAKRFAVNLGTGSSDIALHFNPRFDENG----IVCNSKENGSWGQEEREKAFPFQKGKEFEITILVDPDKFKVKVNGKHVLEYPHRLKLEAVSYLQVEGDIQLTSVSV
PREDICTED: MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAF
View sequence for galectin-like 1 : 134View gene sequenceView neighboring sequences
Cite How to cite