A8MUM7 identified as galectin-like in LectomeXplore
A8MUM7
Redundant proteins identified: 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: YNLPVPYLVTLNAGLKPGSLVTIKGSV-AS--NAKRFAVNLGTGSS---DIALHFNPRFDENGIVCNSKENGSWGQEEREKAFPFQKGKEFEITILVDPDKFKVKVNGKHVLEYPHRLKLEAVSYLQVEGDIQLTSVSV
PREDICTED: SFLTVPY--KLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRR-VVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCHNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVSLDSVLV
View sequence for galectin-like 2 : 137View gene sequenceView neighboring sequences
Cite How to cite