A4D1S0 identified as C-type lectin in LectomeXplore
A4D1S0
Redundant proteins identified: EAL24036.1 KAI2548093.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: EKLKSCPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQQLSKSNSYWIGLTDEKTEGTWQWVDGSPLNY-KNWAPGEPNNAGNEDCVEIKANGWNDVKCEKKKLAICEK
PREDICTED: ARCQQCPPGWVLSEEHCYYFSAEAQAWEASQAFCSAYHATLPLLS--HTQDFLGRYPVSRHSWVGAWRG--PQGWHWIDEAPLPPQLLPEDGE-DNLD-INCGALEEGTLVAANCSTPRPWVCAK
View sequence for C-type lectin 288 : 406View gene sequenceView neighboring sequences
Cite How to cite