D3W0D1 identified as C-type lectin in LectomeXplore
D3W0D1
Redundant proteins identified: KAI2564357.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: LKS----CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQQLSKSNSY-WIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNNAGNEDCVEIKANG-WNDVKCEKKKLAICEKEAAS
PREDICTED: LSGHNYLCPNDWLLNEGKCYWFSTSFKTWKESQRDCTQLQAHLLVIQNLDELEFIQNSLKPGHFGWIGLYVTFQGNLWMWIDEHFLVPELFSVIGPTDDR--SCAVITGNWVYSED-CSSTFKGICQRDAIL
View sequence for C-type lectin 71 : 199View gene sequenceView neighboring sequences
Cite How to cite