Q8IUC8 identified as Ricin-like in LectomeXplore
Q8IUC8
Redundant proteins identified: B3KY85 BAC54545.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: KDGSIRSNQNSDKCLTSSAD---KVITILSCDGS-SSQRWVFKSDGAILNLKNGLAMDVAQSDVSLKKIILLPATGKPNQQWL
PREDICTED: SLGEIR-NVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRT--DDLCLDVSRL--NGPVIMLKCHHMRGNQLWE
View sequence for Ricin-like 429 : 506View sequence for Ricin-like 501 : 551View gene sequenceView neighboring sequences
Cite How to cite