Q10471 identified as Ricin-like in LectomeXplore
Q10471
Redundant proteins identified: A0A1L7NY50 6NQT_A BAF82737.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: G-LCLEANGGW--------------EEQQWALYKDGSIRSNQNSDKCLTSSAD---KVITILSC-DGSSSQRW
PREDICTED: GTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVK---HMDLCLTVVDRAPGSLIKLQGCRENDSRQKW
View sequence for Ricin-like 453 : 522View sequence for Ricin-like 518 : 566View gene sequenceView neighboring sequences
Cite How to cite