Q10472 identified as Ricin-like in LectomeXplore
Q10472
Redundant proteins identified: A0A024RC48 A8KAJ7 BAF85751.1 AAC50327.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
REFERENCE: GSIRSNQNSDKCLTSSAD---KVITILSCDGS-SSQRWVFKSDGAILNLKNGLAMDVAQSDVSLKKIILLPATGKPNQQW
PREDICTED: GEIR-NVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRT--DDLCLDVSKL--NGPVTMLKCHHLKGNQLW
Cite How to cite