P02679 identified as Ficolin-like in LectomeXplore
P02679
Redundant proteins identified: AAB59530.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: RSCKDLLDEGSALSGLYTLL--PDGRALQVFCDMDTDGGGWTVVQRRQDGSVDFYREWANYKQ-FGSA----EGEFWLGNDKIHALTAQGS--SELRVDLVDFEGNNQFAKYKSFKVKDEEEKYKLDLGAFV-GSAGDSLSLHSNK--------------QFSTKDKDRDASESNCAVKVKGAWWYKNCHESN--------GLYLEG-SHESYADGIDWSSAKGYSYSKKVSEMKVRPV
PREDICTED: KDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPF
View sequence for Ficolin-like 177 : 415View gene sequenceView neighboring sequences
Cite How to cite