P02671 identified as Ficolin-like in LectomeXplore
P02671
Redundant proteins identified: KAI2536316.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: ESP-RSCKDLLDEG--SALSGLYTLL-PDGR-ALQVFCDMDTDGGGWTVVQRRQDGSVDFYREWANYKQ-FGSA----EGEFWLGNDKIHALTAQGSSELRVDLVDFEGNNQFAKYKSFKVKDEEEKYKLDLGAFVGSAGDSL-----------SLHSNKQFSTKDKDRDASESNCAVKVKGAWWYKNCHESN--------GLYL--EGSHESYADGIDWSSAKGYSYSKKVSEMKVRP
PREDICTED: SRPVRDCDDVLQTHPSGTQSGIFNIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQRG-SVLRVELEDWAGNEAYAEYH-FRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIENGVVWVSFRGADYSLRAVRMKIRP
View sequence for Ficolin-like 626 : 862View gene sequenceView neighboring sequences
Cite How to cite