Q14314 identified as Ficolin-like in LectomeXplore
Q14314
Redundant proteins identified: A4D1B8 Q53GD2 KAI4014296.1 BAD96719.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: RSCKDLLDEGSALSGLYTLL--PDGRALQVFCDMDTDGGGWTVVQRRQDGSVDFYREWANYKQ-FGSAEGEFWLGNDKIHALTAQGSSELRVDLVDFEGNNQFAKYKSFKVKDEEEKYKLDLGAFVGSAGDSLSLHSNK-----QFSTKDKDRDAS-ESNCAVKVKGAWWYKNCHESN--GLYLEGSHESYADGIDWS--------SAKGYSYSKKVSEMKVRP
PREDICTED: KDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRP
View sequence for Ficolin-like 211 : 434View gene sequenceView neighboring sequences
Cite How to cite