Q15485 identified as Ficolin-like in LectomeXplore
Q15485
Redundant proteins identified: BAA08352.1 KAI4009060.1 BAF83532.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: CSESPRSCKDLLDEGSALSGLYTLL-PDGRALQVFCDMDTDGGGWTVVQRRQDGSVDFYREWANYKQ-FGSAEGEFWLGNDKIHALTAQGSSELRVDLVDFEGNNQFAKYKSFKVKDEEEKYKLDLGAFV-GSAGDSLSLHSNKQFSTKDKDRDASESNCAVKVKGAWWYKNCHESN--GLYLEGSHESYADGIDWSSAKGYSYSKKVSEMKVRPV
PREDICTED: CLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
View sequence for Ficolin-like 98 : 313View gene sequenceView neighboring sequences
How to cite: François Bonnardel, Julien Mariethoz, Serge Pérez, Anne Imberty, Frédérique Lisacek, LectomeXplore, an update of UniLectin for the discovery of carbohydrate-binding proteins based on a new lectin classification, Nucleic Acids Research doi.org/10.1093/nar/gkaa1019