P06734 identified as C-type lectin in LectomeXplore
P06734
Redundant proteins identified: EAW69005.1 CAA28465.1 BAD96927.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: VAALEKKLEELKKEVEKLKS-CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQQLSKSNSYWIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNNAGN-EDCVEIKANG-WNDVKCEKK-KLAICEKEAAS
PREDICTED: REEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATC
View sequence for C-type lectin 142 : 288View gene sequenceView neighboring sequences
How to cite: François Bonnardel, Julien Mariethoz, Serge Pérez, Anne Imberty, Frédérique Lisacek, LectomeXplore, an update of UniLectin for the discovery of carbohydrate-binding proteins based on a new lectin classification, Nucleic Acids Research doi.org/10.1093/nar/gkaa1019