P13611 identified as C-type lectin in LectomeXplore
P13611
Redundant proteins identified: A0A024RAQ9 KAI4021909.1 KAI2538133.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: LKSCPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQQLSKSNSYWIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNN--AGNEDCV--EIKANG-WNDVKCEKKKLAICEKEAASCSKE
PREDICTED: TETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQ-WIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQP
View sequence for C-type lectin 3166 : 3299View gene sequenceView neighboring sequences
Cite How to cite