P02741 identified as Pentraxin in LectomeXplore
P02741
Redundant proteins identified: 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: QTDLSRKVFVFPKESVTDYVSLKAPLEKPLKAFTLCLRAYSELS--RAYSLFSYATKRRDNELLVYKEKVIEYSLTVGRSKVLSKVIEKTVAPVHICVSWESASGIVEFWVDGKPLVKKSLKKGYTVEAEAKIVLGQEQDSYGGKFERSQSLVGEIGDLYMWDSVLSPEEILSIYLGTPLSANVLDWRALKYEVRGEVIIKPLLWV
PREDICTED: QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP
View sequence for Pentraxin 19 : 224View gene sequenceView neighboring sequences
Cite How to cite