Q68DQ2 identified as Ricin-like in LectomeXplore
Q68DQ2
Redundant proteins identified: KAI2530539.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: LCVDVRDEDTGNQIIANGTIINPKQWVG-LCLEANGGWEEQQWALYKDGSIRSNQNSDKCLTSSAD-----KVITILSCDGSSSQRWVFKSDGAILNL-KNGLAMDVAQSD-VSLKKIILL-PATGKPNQQWL
PREDICTED: VYIRIKNRAQGEYLTVTGSLADTR--ATSVCISPYSGKNTQIW-YYCRGLFK-SKASDTCLDVIGGRDTPGAKVALWTEHGQFRQKWRLNKNGTISSYLSDQLVLDVKGGNYCDKTHVIVNQPLEGEETQKWD
View sequence for Ricin-like 2838 : 2966View gene sequenceView neighboring sequences
Cite How to cite