O14967 identified as P-domain of calnexin and reticulin in LectomeXplore
O14967
Redundant proteins identified: A0A140VKG2 A8K454 BAF83508.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: KVYFKEEFEDGD--KWIESKAKKD-L-GKVELSSGKFYGDAE-------DKGLQLSEDAKFYALSAKL-EPFSNKKKTLVVQFEVKKEQDIDCGGGYVKLLPK---LDEEKLHGESEYNIMFGPDKCGGDKKVHVILNYKGKNKLISKEIRAK----------EDELTHLYTLIVRPDNSYEVKIDNSQVESGSLEED---------------------WDLLA-----------------------------------------------PKGSG-----------------------------------------------------------IDNPDYVEDAELYKVDSFAVIGLDLWQVKSGTIFDDILITDDEKEVEDLANETYGV
PREDICTED: EVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKP---DDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRW
View sequence for P-domain of calnexin and reticulin 59 : 446View gene sequenceView neighboring sequences
Cite How to cite