Q9UJ71 identified as C-type lectin in LectomeXplore
Q9UJ71
Redundant proteins identified: B2RC37 KAI4034936.1 BAG37434.1 AAH22278.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: KKAKKEKSELKKVAALEKKLEELKKEVEKLKS-----------CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQQLSKSNSYWIGLTDEKTEGTWQWVDGSPLNY----KNWAPGEPNNAGN-EDCVEIKANG---WNDVKCEKKKLAICEKEAASC
PREDICTED: AQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPS
View sequence for C-type lectin 152 : 326View gene sequenceView neighboring sequences
Cite How to cite