Q9ULY5 identified as C-type lectin in LectomeXplore
Q9ULY5
Redundant proteins identified: 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: KLEELKKEVEKLKS-CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQ-QLSKSNSYWIGLTDEKTEGTWQWVDGSPLNY--KNWAPGEPNNAGN-EDCVEIKANG-----WNDVKCEKKKLAICEKE
PREDICTED: ELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMV
View sequence for C-type lectin 65 : 208View gene sequenceView neighboring sequences
Cite How to cite