P0C7M8 identified as C-type lectin in LectomeXplore
P0C7M8
Redundant proteins identified: 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: LKS--CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQQLSKSNSYWIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNNAGNEDCVEIKANGWNDVKCEKKKLAICE
PREDICTED: C-EAPCPEDWLLYGRKCYFFSEEPRDWNTGRQYCHTHEAVLAVIQSQKELEFMFKFTRREP-WIGLRRV--GDEFHWVNGDPFDPDTFTIAGPG-----ECVFVEPTRLVSTECLMTRPWVCS
View sequence for C-type lectin 96 : 209View gene sequenceView neighboring sequences
Cite How to cite