Q92478 identified as C-type lectin in LectomeXplore
Q92478
Redundant proteins identified: CAA65480.1 AAH05254.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: LKS-CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQQLSKSNSYWIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNNAGNEDCVEIKANGWNDVKCEKKKLAICEK
PREDICTED: SQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMA-KNRTGQWVDGATFTKSFGMRG------SEGCAYLSDDGAATARCYTERKWICRK
View sequence for C-type lectin 31 : 146View gene sequenceView neighboring sequences
Cite How to cite