Q6UVW9 identified as C-type lectin in LectomeXplore
Q6UVW9
Redundant proteins identified: KAI2564359.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: KS--CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQQLSKSNSYWIGLTDEKTEGTWQWVDGSPLN
PREDICTED: KPVACSGDWLGVRDKCFYFSDDTRNWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSRK-QGDSWKWTNGTTFN
View sequence for C-type lectin 54 : 135View gene sequenceView neighboring sequences
Cite How to cite