Q8NC01 identified as C-type lectin in LectomeXplore
Q8NC01
Redundant proteins identified: A0A024RAN6 A8K6B9 AAH67746.1 BAF84273.1 AAF36830.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: ELKKEVEKLKS-CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQ-QLSKSNSY--WIGLTDEKTEGTWQWVDGSPLNY-KNWAPGEPNNAGNEDCVEIKANGWNDVKCEKKKLAICEKEAASCS
PREDICTED: LYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVK
View sequence for C-type lectin 125 : 265View gene sequenceView neighboring sequences
How to cite: François Bonnardel, Julien Mariethoz, Serge Pérez, Anne Imberty, Frédérique Lisacek, LectomeXplore, an update of UniLectin for the discovery of carbohydrate-binding proteins based on a new lectin classification, Nucleic Acids Research doi.org/10.1093/nar/gkaa1019