Q8IUN9 identified as C-type lectin in LectomeXplore
Q8IUN9
Redundant proteins identified: EAW90266.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: LKKVAALEKKLEELKKEVEKLKS-CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQQLSKSNSYWIGLTDEKTEGTWQWVDGSPLNY--KNWAPGEPNN-----AGN-EDCVEIKANG-WNDVKCEKKKLAICEKEAASCSKE
PREDICTED: VQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDP--EGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQE
View sequence for C-type lectin 157 : 314View gene sequenceView neighboring sequences
Cite How to cite