A5D8T8 identified as C-type lectin in LectomeXplore
A5D8T8
Redundant proteins identified: Q8NCF0 A0A024R701 A0A804HJ60 EAW83290.1 KAI4055819.1 NP_775890.2 NP_001372121.1 BAC11199.1 XP_047302558.1 KAI2579664.1 KAI2579434.1 XP_047302593.1 BAF82573.1 AAH78143.1 AAI41809.1 AAP80866.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: QGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQ-------------QLSKSNSY-WIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNNAGNEDCVEIKANG---WNDVKCEKKKLAICEKEAASCSK
PREDICTED: DGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDILAFYLGRLETTNEVIDSDFETRNFWIGLTYKTAKDSFRWATGEHQAFTSFAFGQPDNHGFGNCVELQASAAFNWNDQRCKTRNRYICQFAQEHISR
View sequence for C-type lectin 307 : 441View gene sequenceView neighboring sequences
Cite How to cite