Q5QGZ9 identified as C-type lectin in LectomeXplore
Q5QGZ9
Redundant proteins identified: AAI26290.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: EKSELKKVAALEKKLEELKKEVEKLKS-CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQQLSKSNSYWIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNNAGNEDCVEIKANGWNDVKCEKKKLAICEKEAASCS
PREDICTED: NLSTTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDN-IINSSAWVIRNAPDLNNMYCGYINRLYVQYYHCTYKKRMICEKMANPVQ
View sequence for C-type lectin 105 : 256View gene sequenceView neighboring sequences
Cite How to cite