Q07108 identified as C-type lectin in LectomeXplore
Q07108
Redundant proteins identified: Q53ZX0 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: EKLKSCPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQQLSKSNSYWIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNNAGNEDCVEIKANGWNDVKCEKKKLAICEKEA
PREDICTED: SHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKE-PGHPWKWSNGKEFN--NWFNV----TGSDKCVFLKNTEVSSMECEKNLYWICNKPY
View sequence for C-type lectin 80 : 198View gene sequenceView neighboring sequences
Cite How to cite